PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS69011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family HD-ZIP
Protein Properties Length: 205aa    MW: 23078 Da    PI: 8.4953
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS69011.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-1854108256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++keq  +Lee F+++++++ ++++eLA +l L+ rqV vWFqNrRa+ k
  EPS69011.1  54 RKKLRLSKEQAAVLEETFKEHNTLNPKQKKELAVRLLLKPRQVEVWFQNRRARTK 108
                 788899***********************************************98 PP

2HD-ZIP_I/II121.93.2e-3954143191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+++LEe+F+e+++L+p++K+ela +L l+prqv+vWFqnrRARtk+kq E+d+e+L+r++++l++en+rL+kev+eLr +l
   EPS69011.1  54 RKKLRLSKEQAAVLEETFKEHNTLNPKQKKELAVRLLLKPRQVEVWFQNRRARTKLKQAEVDCEYLRRCCENLTQENRRLQKEVSELR-AL 143
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.3E-8432IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.604.7E-1839108IPR009057Homeodomain-like
SuperFamilySSF466892.1E-1748111IPR009057Homeodomain-like
PROSITE profilePS5007116.92550110IPR001356Homeobox domain
SMARTSM003891.2E-1352114IPR001356Homeobox domain
CDDcd000869.13E-1454111No hitNo description
PfamPF000466.1E-1654108IPR001356Homeobox domain
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
PfamPF021836.5E-10110144IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.9E-24110153IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
AATAIDGDEE PPMASSPNST VSSLSGKRSE REENDGERAS SSLEIDDGGD AEARKKLRLS  60
KEQAAVLEET FKEHNTLNPK QKKELAVRLL LKPRQVEVWF QNRRARTKLK QAEVDCEYLR  120
RCCENLTQEN RRLQKEVSEL RALKLSPQFY MNMSPPTTLA MCPQCERVVN VPSSSPPSAA  180
PRHLHRPNSW ASMFPSLPAS DAHRP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102110RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089804.11e-103PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466027e-76HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLS8CVM61e-150S8CVM6_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc01g090460.2.11e-92(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.11e-76homeobox-leucine zipper protein 3
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]